PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 251aa    MW: 28023.1 Da    PI: 9.6154
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592753.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.61.8e-32116172158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     d p+YVNaKQy++I++RRq Rakle+++kl  k+rkpylheSRh hA++R RgsgGrF
  XP_009592753.1 116 DGPIYVNAKQYHGIMRRRQIRAKLEAQNKL-VKNRKPYLHESRHLHAVNRVRGSGGRF 172
                     57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.9E-36114175IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.974115175IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.7E-28118172IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-23118140IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860120140IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.5E-23149172IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKSLDPDLQG ETLRLTHSTI NSQDEMTTSE KTNSQDQCAS SEYVHDERYG RDMQVQIKPA  60
LFSSQNEVAH STGFSPFGYS DPYMSGLYTA YGPQAFPQMT GIAPTRVPLP LDLAEDGPIY  120
VNAKQYHGIM RRRQIRAKLE AQNKLVKNRK PYLHESRHLH AVNRVRGSGG RFLSSKKVNQ  180
SDPNSYPTNS TSSQDSVERE NSTSAFSSVR KDVNNGVSFQ QQPDHRAFGV SSHMAITMQG  240
NGAQQRAPIV R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21118185474NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592750.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLM0ZH821e-166M0ZH82_SOLTU; Uncharacterized protein
STRINGSolyc12g009050.1.11e-163(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.41e-42nuclear factor Y, subunit A8